8Z4EA

Structure of human 18_14d scfv and 1g01 scfv in complex with influenza virus neuraminidase from a/yunan/dq001/2016 (h5n6)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
379
structure length
339
Chain Sequence
RTFLNLTKPLCEVNSWHILSAHILVTREPYLSCDPQGCRMFALSQGPFRALISWEMGQAPSPYNTRVECIGWSSTSCHDGISRMSICISGPNNNASAVVWYRGRPVTEIPSWVGNILRTQESECVCHKGICPVVMTDGPANNKAATKIIYFKEGKIQKIEELQGNAQHIEECSCYGAAGMIKCVCRDNWKGANRPIITIDPEMMTHTSKYLCSKILTDTSRPNDPTNGNCDEPITGGSPDPGVKGFAFLDGENSWLGRTISKDSRSGYEMLKVPNAETDTQSGPTSYQLIVNNQNWSGYSGAFIDYWANKECFNPCFYVELNSMVALCGSRERLGSWSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A human monoclonal antibody targeting the monomeric N6 neuraminidase confers protection against avian H5N6 influenza virus infection.
pubmed doi rcsb
molecule keywords Neuraminidase
molecule tags Viral protein
source organism Influenza a virus
total genus 63
structure length 339
sequence length 379
ec nomenclature ec 3.2.1.18: exo-alpha-sialidase.
pdb deposition date 2024-04-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...