8Z75A

The structure of non-activated thiocyanate dehydrogenase from pelomicrobium methylotrophicum (pmtcdh)
Total Genus 138
50100150200250300350400450020406080100120140
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
464
structure length
464
Chain Sequence
KIEEFYAQFGKYILLVPGKFTGTVAAHDLSTGRTLAWLAGWNYGDTNPIMHHMAAFPSPDPYKGFEFIVNTQGGKNLFIYGIPTTVKEPGEGFNIYRVRYDGTKFNLVSNIAEKTGLGLGVHVTATPDGKGFAVADGQKDIFAEFDLATESVRTAFLVDWKPNNSDLKRAWLEGGTMTITRLKPTLPGGKYDYTGTKGCKIDWELVPGGELFLEEGKVTGTRQTNVVALDAFVYDPRGRWGALSARLPGVAIIFDRQDWEPVVALVGAKGEPSSLPVKKVASDTWEIKMDKVVTPAHQAGFSPDGKNFLFMNGVRQNNIMVWDTSNHADPTKWTKKAVVEDPGWRGSYPNTFHMVFTPDGRKVYVTLWWPSPTPNGIAVVDARNWKLLKSVDIGPDMHTLAITYDGKYVVGVFSGYQKTASGIVIMDTKSDEVVGILPSVGGHHDCVIVPKTVEDLRCSRCTTT
50100150200250300350400450400300200100
020406080100120Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
source organism Pelomicrobium methylotrophicum
publication title The structure of non-activated thiocyanate dehydrogenase from Pelomicrobium methylotrophicum (pmTcDH)
rcsb
molecule keywords Twin-arginine translocation signal domain-containing protein
total genus 138
structure length 464
sequence length 464
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2024-04-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.