8ZD6A

Crystal structure of e40k variant of cu/zn-superoxide dismutase from dog (canis familiaris) in the apo form complexed with 22e1 fv-clasp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
153
structure length
130
Chain Sequence
MEMKAVCVLKGQGPVEGTIHFVQKGSGPVVVSGTITGLTKGEHGFHVHQFGDNTQGCTSAGPHFNPLSKDQERHVGDLGNVTAGKDGVAIVSIEDSLIALSGDYSIIGRTMVVHEKRDSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Disulfide-mediated oligomerization of mutant Cu/Zn-superoxide dismutase associated with canine degenerative myelopathy.
pubmed doi rcsb
molecule keywords Superoxide dismutase [Cu-Zn]
molecule tags Metal binding protein
source organism Canis lupus familiaris
total genus 30
structure length 130
sequence length 153
chains with identical sequence D, G, J
ec nomenclature ec 1.15.1.1: superoxide dismutase.
pdb deposition date 2024-05-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...