8ZN8A

Mjf-3c-cds qds
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
169
structure length
169
Chain Sequence
ASQVRQNYHEDAEASINKQINMCLYASYVYLSMAYYFERDDVALPGFAKFFKESSDCCREHAQTFMKYQNKRGGRIVLQQIAAPSMQEWGTGLEALQAALDLEKQVNQSLLELHSTASGNNDPHLTKLLEDEYLEEQVDSIKKIGDMITKLKRAGPTGLGEYMFDKELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Construction of an artificial photosynthesis system by incorporation of CdS quantum dots into the intrasubunit interface of a four-helix-bundle-structure enzyme
rcsb
molecule keywords Ferritin
molecule tags Metal binding protein
source organism Penaeus japonicus
total genus 73
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.1: ferroxidase.
pdb deposition date 2024-05-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...