9B0MA

Crystal structure of macrophage migration inhibitory factor from plasmodium vivax
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
101
structure length
96
Chain Sequence
MPCCQVSTNINASDDDAKKALSQIENAISQVLGKPLGYIMSNLDYQKHMRFGGSHDGFCFVRVTSKSNNSSLADKITKILASTLNVKSERVFIEFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Macrophage migration inhibitory factor from Plasmodium vivax
rcsb
molecule keywords L-dopachrome isomerase
molecule tags Cytokine
source organism Plasmodium vivax sal-1
total genus 30
structure length 96
sequence length 101
ec nomenclature ec 5.3.2.1: phenylpyruvate tautomerase.
pdb deposition date 2024-03-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...