9B1RA

Functional implication of the homotrimeric multidomain vacuolar sorting receptor 1 from arabidopsis thaliana
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
445
structure length
427
Chain Sequence
FVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHPDERVEYELWTNSNDECGKKCDTQIEFLKNFKGAAQILEKGGHTQFTPHYITWYCPEAFTLSKQCKSQCINHGRYCAPDPEQDFTKGYDGKDVVVQNLRQACVYRVMNDTGKPWVWWDYVTDFAIRCPMKEKKYTKECADGIIKSLGIDLKKVDKCIGDPEADVENPVLKAEQESQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAMCSGFQESTEPAICLTEDLETNECLENNGGCWQDKAANITACRDTFRGRLCECPTVQGVKFVGDGYTHCKASGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Functional implication of the homotrimeric multidomain vacuolar sorting receptor 1 (VSR1) from Arabidopsis thaliana.
pubmed doi rcsb
molecule keywords Vacuolar-sorting receptor 1
molecule tags Protein transport
source organism Arabidopsis thaliana
total genus 125
structure length 427
sequence length 445
ec nomenclature
pdb deposition date 2024-03-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...