9BE2A

Structure of the e. coli nucleic associated protein, yejk
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
335
structure length
335
Chain Sequence
MSLDINQIALHQLIKRDEQNLELVLRDSLLEPTETVVEMVAELHRVYSAKNKAYGLFSEESELAQTLRLQRQGEEDFLAFSRAATGRLRDELAKYPFADGGFVLFCHYRYLAVEYLLVAVLSNLSSMRVNENLDINPTHYLDINHADIVARIDLTEWETNPESTRYLTFLKGRVGRKVADFFMDFLGASEGLNAKAQNRGLLQAVDDFTAEAQLDKAERQNVRQQVYSYCNEQLQAGEEIELKSLSKELAGVSEVSFTEFAAEKGYELEESFPADRSTLRQLTKFAGSGGGLTINFDAMLLGERIFWDPATDTLTIKGTPPNLRDQLQRRTSGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Nucleoid-associated protein YejK
publication title Structure of the E. coli nucleic associated protein, YejK
rcsb
source organism Escherichia coli
total genus 66
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2024-04-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...