9BKYA

Crystal structure of a c2 domain from trichomonas vaginalis (sulfate bound)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
131
structure length
131
Chain Sequence
HMTLTFNIKVIEAKDLPKVDTFGKVDPYVQIQLGNEKCKTKVIKKSYNPVWNETFSIPVTNPKAPLNITVVDYDFIGSNDAFAYIHFNQQEFNVGQVVDKWYMLNSYKAGRSAGQIHLVIHLATQNMKPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a C2 domain from Trichomonas vaginalis (sulfate bound)
rcsb
molecule tags Lipid binding protein
source organism Trichomonas vaginalis g3
molecule keywords XYPPX repeat family protein
total genus 21
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2024-04-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...