9C5MA

Trypanosoma cruzi r19t/k20s/c64y mutant beta-3-hbdh structure in complex with nadh and malonate (p1 space group)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
262
Chain Sequence
KRVLSGRVAVVTGSTSGIGLGIAMRLAMAGADVVLNGRRQSPEDSAIVEKVAAYGTRVRYFAANMKDRAQVEALIKFTEKELGAVEILVNNAGIQHVSPVETFPSDKWDEIIALNLTSAFHATQLCLPSMRQRGWGRIINIASVQGLVGSMNKSAYCAAKHGLIGFTKVVALETATTGITCNAICPGYVYTPLVEEQIKAVAEAKYGGDMEAATQAFLCEKQPAKAFVTVEQVGDAAVFLASPGADMIRGTTITVDGGWVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Trypanosoma cruzi D-3-hydroxybutyrate dehydrogenase (HBDH) is NADP-dependent enzyme.
rcsb
molecule keywords Hydroxybutyrate dehydrogenase
molecule tags Oxidoreductase
source organism Trypanosoma cruzi
total genus 99
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2024-06-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...