9C5OA

Trypanosoma cruzi r42f mutant beta-3-hbdh structure
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
263
structure length
263
Chain Sequence
EKRVLSGRVAVVTGSRKGIGLGIAMRLAMAGADVVLNGFRQSPEDSAIVEKVAAYGTRVRCFAANMKDRAQVEALIKFTEKELGAVEILVNNAGIQHVSPVETFPSDKWDEIIALNLTSAFHATQLCLPSMRQRGWGRIINIASVQGLVGSMNKSAYCAAKHGLIGFTKVVALETATTGITCNAICPGYVYTPLVEEQIKAVAEAKYGGDMEAATQAFLCEKQPAKAFVTVEQVGDAAVFLASPGADMIRGTTITVDGGWVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Trypanosoma cruzi D-3-hydroxybutyrate dehydrogenase (HBDH) is NADP-dependent enzyme.
rcsb
molecule keywords Hydroxybutyrate dehydrogenase
molecule tags Oxidoreductase
source organism Trypanosoma cruzi
total genus 94
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2024-06-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...