9CMKA

Crystal structure of p110alpha-ras binding domain (rbd) in complex with molecular glue d927
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
133
Chain Sequence
MYVYPPNVESSPELPKHIYNKLDKGQIIVVIWVIVNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular glues that facilitate RAS binding to PI3K alpha promote glucose uptake without insulin.
pubmed doi rcsb
molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
molecule tags Signaling protein
source organism Homo sapiens
total genus 34
structure length 133
sequence length 135
chains with identical sequence B
ec nomenclature ec 2.7.1.137: phosphatidylinositol 3-kinase.
pdb deposition date 2024-07-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...