9DQCA

Hare calicivirus protruding domain and a-trisaccharide complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
332
structure length
332
Chain Sequence
SPAGLLTTPVLTGAGSDNRWGAQIVALQPVPSGFSTCNRHWNLNGSTFGWSSPRFSDIDHPRGNASYTGTGSTNVIETWYANTGTATNNPISNIAPDGFPDMGAIGFSGQTIPTGGWVGFGEVWNVANGSPYNGTVQAYELGFATGAPNSINPATTTVGTQIVAKSIYGVAIGQNQQTAGLFVLSTGIVSTSGPNATTYTPQPNSIVVAPGTPAAAPIGRNVPVMFSGVIRRAGDINAGAGSVNGTQYGVGSQPISVTLQLSLTNYSSSLQPGQFFVWQLNFASGFLEIGLNVDGYFYIGAGASSNMIELTELIDVRPVGVRPNTSTLVFNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of a non-pathogenic hare calicivirus capsid bound to a histo-blood group antigen co-factor.
pubmed doi rcsb
molecule keywords Hare calicivirus protruding domain
molecule tags Viral protein
source organism Hare calicivirus australia-1
total genus 74
structure length 332
sequence length 332
chains with identical sequence B
ec nomenclature ec 3.6.1.15: nucleoside-triphosphate phosphatase.
pdb deposition date 2024-09-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...