9EOJS

Vertebrate microtubule-capping gamma-tubulin ring complex
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
1693
structure length
661
Chain Sequence
SITKLFGDLCESHMVGFSKNRTKQTLKKLAYDTLFVHLFPVKNKIIMLSFNLRICGMSSEADRLEELVEYLEQHAVLELLVELSGQPQLVLLEETDLVKAVLNVLIGVVSSTFSYNQALQSFAVKQGVYISGTSPDNVSSLLTQVAEYGTYYTRLSHFSLLTVLDSSHSNGLVFQAFTSGLRKYLQYYRACVLSTPASLTLLTISFLFRKLGRQLRYLAELCCAFPTGVKLLSYLYKEALENSSNENYPVLLSLLKTSCEPYTRFIYDWVYSGVFRDVCGEFMIQVNEDYLGFRDKRYWTHGYVLISKEVEDCVPVFLKHVANEIYICGKTINLLKLCSLPVLMKYSVTAPMVSHVYLVNKAIVDYYFVELKMERHFEAMRHFLLMEDGEFAQSLSDMLFEKLGSGQTPSELLNPLVLNSILNKALQYSLHGDSSLASNLTFALKYLPEVFTPTAPDALSCLELKYKVDWPLNIVITDTCMNKYSRIFSFLLQLKHMVWTLRDVWFHLKRTALVNQASNSVQYRQLQLYRHEMQHFVKVIQGYIANQILHVTWCEFRNKLSAVSNLEEIYKTHADYLNKALFRGLLTEKAAPLMNIIHSIFSLILKFRLQLISNFGLMQQSYNTFKYYSDFLFEVVSKLVNRGYQPHLEDFLLRINFNSYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Mitotic-spindle organizing protein 1
publication title gamma-TuRC asymmetry induces local protofilament mismatch at the RanGTP-stimulated microtubule minus end.
pubmed doi rcsb
total genus 173
structure length 661
sequence length 1693
ec nomenclature
pdb deposition date 2024-03-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...