9F63A

Crystal structure of saccharomyces cerevisiae ph nine-sensitive protein 1 (pns1)
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
461
structure length
422
Chain Sequence
RWNDWPFTIFFLCTVGGFIAIAAITLRAWSQTYSSTGSGNAAILLVFVCIIALVFSVLGLTLCRIFPKQFIYCGMVINLVASLGTAIMYMSLRYWSAGIVFLVFTFMTAWCYWGMRSRIPLSVAVLKVVVDAMKKCPQIFFVSFVGALVASAFGFLFSAVIVATYIKYHSKLIGVLVVVFFCGYYISEVIRNVIHCVISGVFGSWYYMSKSDQGMPRWPAFGALKRAMTYSFGSICFGSLLVALIDLLRQILQMIRHDVTSSGGGQIAIQILFMVFDWIIGFLKWLAEYFNHYAYSFIALYGKPYLRAAKETWYMLREKGMDALINDNLINIALGLFSMFASYMTALFTFLYLRFTNGALMAFSFVIALQICNIATEAIRSGTATFFVALGNDPEVFHHSYPHRFDEIFRAYPDVLRKLSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title S. cerevisiae pH nine-sensitive protein 1 is not a choline transporter.
rcsb
molecule tags Membrane protein
source organism Saccharomyces cerevisiae
molecule keywords Protein PNS1
total genus 190
structure length 422
sequence length 461
ec nomenclature
pdb deposition date 2024-04-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...