9FCMA

Single-domain antibody binding the sars-cov2 s2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
122
Chain Sequence
QVQLQESGGGLVQAGDSLTLSCAVSGRIFSTYTMGWFRQAPGKEREFVAAVRWGAGTIYYADRFTISRDSAKNTVDLQMNSTKPEDTAVYYCGAAYVSKANYGSLWYQDSRRYDYWGQGTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ultrapotent SARS coronavirus-neutralizing single-domain antibodies that clamp the spike at its base.
pubmed doi rcsb
molecule keywords Single-domain antibody R3DC23
molecule tags Antiviral protein
source organism Lama glama
total genus 28
structure length 122
sequence length 126
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2024-05-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...