9FLZA

Alcohol dehydrogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
341
structure length
336
Chain Sequence
KTMKAAVVREFGKPLTIDEVPVPEPGPGMIQVRIQASGVCHTDLHAAEGDWPVKPNPPFIPGHEGVGFVSAVGAGVKHVKEGDRVGVPWLYTACGHCRHCLGGWETLCESQLNTGYSVNGGFADYVVADPNYVGHLPKNVDFLDIAPVLCAGVTVYKGLKVTDTKPGDWVVISGIGGLGHMAVQYAKAMGMNVAAVDIDDEKLALARKLGATVTVNAATEPDPAAAIRKQTDGGAQGVLVTAVGRKAFEQAIGMVARGGTVALNGLPPGDFPLDIFGMVLNGITVRGSIVGTRLDLQESLDFAGDGKVKATVHKAKLEDINNIFGQMHGRMVLDMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NAD-dependent dehydrogenase
rcsb
molecule keywords alcohol dehydrogenase
molecule tags Oxidoreductase
source organism Paracoccus denitrificans
total genus 85
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: alcohol dehydrogenase.
pdb deposition date 2024-06-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...