9GARA

Siderophore-binding lipoprotein xusb from barnesiella viscericola
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
463
structure length
458
Chain Sequence
ATPTEVSNLTEVSKGNYVIAATVGTGNNETNVLLTADRLDDPNYKVTPTVQGTQNDGATYWVFYNQRSLFALNYNQTASYSLNPAFEMTKDPRTYKLSRFTTYGFYNDYIMTTSSGSGTIDAQSYTYTDKSGQSLTETYYPRHFLPAYIDARNQTAKDGTGAGDIRLRAENFLGNGEYVTLAGLEQVGNYLYSAAVPMGLSQWGYIQTVDGREHGYVREGYEDLVKTESGGSGSGSYKANELQWTQYPDECWVAIFKDETLTEHKVIKSDRISYACGRNRSQYYQMVWQADDGYLYVFSPSYAKTMSDARQQTRLPAGVVRIDTRASWEALDFDPSYYQALKNPDGSEAAFLRSWYTSGNYFLLLAYDAQGFKGTANRLLIFDTQGDGTLREVSGLPTDISALSNTPYIDDEGHAYVVVSTSTGYPTVYKIDPAAATASKGLTIVATSVAGVGKLQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of iron piracy by human gut Bacteroides.
pubmed doi rcsb
molecule keywords DUF4374 domain-containing protein
molecule tags Metal transport
source organism Barnesiella viscericola dsm 18177
total genus 97
structure length 458
sequence length 463
ec nomenclature
pdb deposition date 2024-07-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...