9GKXA

Crystal structure of rhizorhabdus wittichii dimethoate hydrolase (dmha) in complex with saha
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
366
structure length
366
Chain Sequence
RTGFYTDERTFWHATGMQALFLPVGDWVQPPNGTAGADTPDSKRRLLNLAHASGLIRKLTLPEAIPATVEDVCRVHPRDYIDRFKATSDAGGGDLGHLAPFSKGGYEIAMLSCGLAIAAVDDVLSGKVDNAYALCRPAGHHCLADTPMGFCLLANIPIAIEAAKARHGISRVAVVDWDVHHGNGTQSIFYDRADVLTISIHQDRCFPPGYSGAEDRGEGAGLGYNLNVPLPAGAGHDAYVQAFDDIVVPALDDFKPDLIIVASGLDANSVDPLARMLLHSESYRLLTQKMLDAAARLCGGKLVVVHEGGYAEAYVPFCGHALLEALSGERTAVVDPVLEMAEAWQPGPEAAAFHRQWIDRLVADLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distribution and diversity of classical deacylases in bacteria.
pubmed doi rcsb
molecule keywords Dimethoate hydrolase
molecule tags Hydrolase
source organism Rhizorhabdus wittichii dc-6
total genus 139
structure length 366
sequence length 366
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2024-08-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...