9GWZAAA

Crystal structure of 23me-00610 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
218
Chain Sequence
EVQLQESGPGLVKPSETLSLTCTVSGFSLTNYAVSWVRQPPGKGLEWLGVMWAGGGTNYNSVFKSRLTISKDNSKNQVSLKLSSVTAADTAVYYCARERPLTGVMDYWGQGTLVTVSSASTKGPSVFPLAPSSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CD200R1 immune checkpoint blockade by the first-in-human anti-CD200R1 antibody 23ME-00610: molecular mechanism and engineering of a surrogate antibody.
pubmed doi rcsb
molecule keywords 23ME-00610 Fab (heavy)
molecule tags Antitumor protein
source organism Homo sapiens
total genus 43
structure length 218
sequence length 219
chains with identical sequence CCC, EEE, HHH
ec nomenclature
pdb deposition date 2024-09-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...