9HISI

Extracellular components bamhijk of the bacteroides thetaiotaomicron bam machinery
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
169
structure length
169
Chain Sequence
KYDNWRARNEAFIDSLANVYATASGRGGLERIEMLTAPGNYIYYKEMEPMTDHVVKAGNPKYTDYVKVYYKGTNILGEYFDGNFKGDNPVVDGKDPSEGDSPTTIFQVSGVITGWGEVLQRMEVGDRWKVYIPWDYAYGSSGTTGILGYSALVFDITLLDFANTEAELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Extracellular components BamGHIJ of the Bacteroides thetaiotaomicron BAM machinery
rcsb
molecule keywords DUF6242 domain-containing protein
molecule tags Membrane protein
total genus 34
structure length 169
sequence length 169
ec nomenclature ec 5.2.1.8: peptidylprolyl isomerase.
pdb deposition date 2024-11-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...