9IIZA

Cryo-em structure of efpiwi-pirna-target (25-nt, comma)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
404
structure length
377
Chain Sequence
RLPPEKILFKHSSIVANMEADWSRECLKEHVISAVSLLDWAVLFVRKDQGKATDFVNMLSKVCPPIGMEVHEPKMVEVVNDRTESYLRALRELIAPRLQMVVIVFPTSRDDRYSAVKKLCCIESPIPSQVLIARTITQQQKLRSVAQKVALQMNAKLGGELWAVEIPLKSCMVVGIDVYHDKSYGNKSIAGFVASTNPSFTRWYSRTAMQEQSQELIHELKLCMQAALKKYNEMNQSLPERIIVFRDGVGEGREEYVSEFEVPQFNSCFSIFGENYCPKLAVVVVQKRISYDFYLVSQHVRQGTVSPTYYRVIYDKSGLKPDHLQRLTYKLTHMYYNWPGTIRTPAPCNYAHKLAFLVGKSLHRDPAHELSDRLFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into RNA cleavage by PIWI Argonaute.
pubmed doi rcsb
molecule keywords Piwi
molecule tags Rna binding protein/rna
source organism Ephydatia fluviatilis
total genus 71
structure length 377
sequence length 404
ec nomenclature
pdb deposition date 2024-06-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...