9IT2C

Cryo-em structure of urease from ureaplasma parvum
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
598
structure length
597
Chain Sequence
MFKISRKNYSDLYGITTGDSVRLGDTNLWVKVEKDLTTYGEESVFGGGKTLREGMGMNSTMKLDDKLGNAEVMDLVITNALIVDYTGIYKADIGIKNGKIAAIGKSGNPHLTDNVDMIVGISTEISAGEGKIYTAGGLDTHVHWLEPEIVPVALDGGITTVIAGGTGMNDGTKATTVSPGKFWVKSALQAADGLSINAGFLAKGQGMEDPIFEQIAAGACGLIHEDWGATGNAIDLALTVADKTDVAVAIHTDTLNEAGFVEHTIAAMKGRTIHAYHTEGAGGGHAPDILETVKYAHILPASTNPTIPYTVNTIAEHLDMLMVCHHLNPKVPEDVAFADSRIRSQTIAAEDLLHDMGAISIMSSDTLAMGRIGEVATRTWQMAHKMKAQFGSLKGDSEFSDNNRVKRYISKYTINPAIAHGVDSYIGSLEVGKLADIVAWEPKFFGAKPYYVVKMGVIARCVAGDPNASIPTCEPVIMRDQFGTYGRLLTNTSVSFVSKIGLENGIKEEYKLEKELLPVKNCRSVNKKSMKWNSATPNLEVDPQTFDAAVDFNDLENWLEQSASELAKKLKKTSSGKYILDAEPLTEAPLAQRYFLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis and Molecular Dynamics Simulations of Urease From Ureaplasma parvum.
pubmed doi rcsb
molecule keywords Urease subunit gamma
molecule tags Hydrolase
total genus 201
structure length 597
sequence length 598
chains with identical sequence F, I
ec nomenclature ec 3.5.1.5: urease.
pdb deposition date 2024-07-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...