9KX8A

Mistletoe lectin i from viscum album complexed with epimer form of lactose
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
247
structure length
247
Chain Sequence
YERLRLRVTHQTTGAEYFSFITLLRDYVSSGSFSNEIPLLSQSTIPVSDAARFVLVELTNEGGDSITAAIDVTNLYVVAYQAGDQSYFLRDAPRGGETHLFTGTTKSALPFNGSYPDLERYAGHRDQVPLGIDQLIQSVTALRFPGGSTRTQARSILILIQMISEAARFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQHSTDGVFNNPIRLALSPGNFVTLTNVRDVIASLAIMLFVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mistletoe Lectin I from Viscum album complexed with epimer form of lactose
rcsb
molecule keywords Beta-galactoside-specific lectin 1 chain A isoform 1
molecule tags Plant protein
total genus 68
structure length 247
sequence length 247
ec nomenclature ec 3.2.2.22: rRNA N-glycosylase.
pdb deposition date 2024-12-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...