9MK9A

Structure of the ifit2-ifit3 heterodimer from mus musculus
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
440
structure length
440
Chain Sequence
ESLVCNLRQLKCHFTWNLIAEDESLDEFEDRVFNKDEFQNSEFKATMCNILAYVKHCRGLNEAALQCLGEAEGFIQQQHPDQVEIRSLVTWGNYAWVYYHMGQFSKAQAYLDKVKQVCKKFSSPYRIENPALDCEEGWARLKCTKNQNERVKVCFQKALEKDPKNPEFTSGWAIANYRLDDWPARNYCIDSLEQAIQLSPDNTYVKVLLALKLDAVHKNQAMALVEEALKKDPSAIDTLLRAARFYCKVYDTDRAIQLLRKALEKLPNNAYVHYYMGCCYRSKVHHMLNRREMVFSGDRKKLEELIQLAVNHLRKAEEIKEMLEYSCSFLADLYIIAKKYDEADYYFQKELSKDLPPGPKQLLHLRYGNFQFFQMKRQDKAIYHYMEGVKIKKKTIPQKKMREKLQRIALRRLHEDESDSEALHILAFLQENGGGQQADK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Short 5' UTRs serve as a marker for viral mRNA translation inhibition by the IFIT2-IFIT3 antiviral complex.
pubmed doi rcsb
molecule keywords Interferon-induced protein with tetratricopeptide repeats 2
molecule tags Antiviral protein
source organism Mus musculus
total genus 126
structure length 440
sequence length 440
ec nomenclature
pdb deposition date 2024-12-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...