9N5AA

Cryoem structure of azotobacter vinelandii bacterioferritin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
155
structure length
155
Chain Sequence
MKGDKIVIQHLNKILGNELIAINQYFLHARMYEDWGLEKLGKHEYHESIDEMKHADKLIKRILFLEGLPNLQELGKLLIGEHTKEMLECDLKLEQAGLPDLKAAIAYCESVGDYASRELLEDILESEEDHIDWLETQLDLIDKIGLENYLQSQMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CryoEM-enabled visual proteomics reveals de novo structures of oligomeric protein complexes.
pubmed doi rcsb
molecule keywords Bacterioferritin
molecule tags Metal binding protein
total genus 67
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.16.3.1: ferroxidase.
pdb deposition date 2025-02-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...