9NDJH

Cryo-em structure of the endogenous clpp1/clpp2 heterocomplex from pseudomonas aeruginosa bound to the aaa+ clpx unfoldase.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
191
Chain Sequence
LVPMVVEQSARGERAYDIYSRLLKERIIFLVGQVEDYMANLVVAQLLFLEAENPEKDIHLYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGALLLAGGAAGKRYCLPHSRMMIHQPLGGFQGQASDIEIHAKEILFIKERLNQILAHHTGQPLDVIARDTDRDRFMSGDEAVKYGLIDKVMTQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of ClpX from Pseudomonas aeruginosa
rcsb
molecule keywords ATP-dependent Clp protease ATP-binding subunit ClpX
molecule tags Chaperone
source organism Pseudomonas aeruginosa
total genus 47
structure length 191
sequence length 191
chains with identical sequence I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: endopeptidase Clp.
pdb deposition date 2025-02-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...