9O0IH

Cryo-em structure of local kwaa-kwab complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
315
structure length
315
Chain Sequence
MTTQQLKEKISKIIDNFSGIRVVFTTTANELKLSRIEGSALNSIAEGFIDKIKEDIINNEDLTSPLLSNFDDRKNALFKFDYEQYPEEFNKITQAIAIPPNSQDYYNPLNKFTDVKGIIILISGDNKCLALYKNKTNLAVLRNSRKMFNLVPDPDGYLKQLPNEILRLDFNYDLFSIGEDFYIKNHKTLETQMKFHQVIEAQAVIALNSLRDSLLIEDISGLEKSSREISFARKLAKISKHSPVLGKIDTKTIIDYVSQHKYLSAILQINEAGDKLLIKTKTSQKHFIKLMSDDYLQSDLTKIIYMSIAKDRLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of Local KwaA-KwaB complex.
rcsb
molecule keywords Kiwa protein KwaA
molecule tags Antiviral protein
source organism Escherichia coli
total genus 68
structure length 315
sequence length 315
chains with identical sequence J
ec nomenclature
pdb deposition date 2025-04-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...