9O5UA

Cryoem structure of siamese algae-eater influenza-like virus (saeilv) na
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
386
structure length
386
Chain Sequence
PTYFQPRMSCTGTRFQPFMMMNSPRYGGTGDRGSIHLNREPFVSCSMNECRHFALGHTATQNGPYSAGTGADRSIQRMLFSTKLGEPFTIDNAIVHMSGWSGSACHDGVEWTYVTVFGTDPDALVKTKYGNNLVDSYRSFAGNILRTQESECVCLNGSCYVMITDGYAGGGGVSQARFLVMKQGKIIDVINTSGRSKFTEECTCAATGNTTIMCACRDNAYTDRRPIVAIDTIAKTANVGLMCSPTRMDTPRSADSAPSSCNVDDGTGGGGVKGGFAVVRRPNGNQFYYTRTGSASSRVGMEVRGPQTEDPMTGTSAIPLLDIIVSTSVNTGYSSSFEMKGIECDTPCFVVEHIRSNTWTTASSSIYCLSGDASMFQFDDGVNPTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of the glycoproteins of novel fish influenza B-like viruses.
pubmed doi rcsb
molecule keywords Neuraminidase
molecule tags Hydrolase
source organism Siamese algae-eater influenza-like virus
total genus 92
structure length 386
sequence length 386
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.18: exo-alpha-sialidase.
pdb deposition date 2025-04-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...