9PFGJ

Min22bin20s complex (nsf-alphasnap-2:2 syntaxin-1a h3:snap-25 sn1), 4:2:2 alphasnap-syntaxin-1a h3-snap-25 sn1 subcomplex local refinement, non-hydrolyzing, class 28
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
201
structure length
185
Chain Sequence
MAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAKIEVGLVVGNSQVAFEKAENSSLNLIGKAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural remodeling of target-SNARE protein complexes by NSF enables synaptic transmission.
pubmed doi rcsb
molecule keywords Synaptosomal-associated protein 25
molecule tags Hydrolase
source organism Rattus norvegicus
total genus 26
structure length 185
sequence length 201
chains with identical sequence K
ec nomenclature ec 3.6.4.6: vesicle-fusing ATPase.
pdb deposition date 2025-07-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...