9QUUA

Triosephosphate isomerase of rhodococcus sp. jg-3
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
ARKPLIAGNWKMNLNHLEAISLVQKIAFSLPEKYFDKVDVTVIPPFTDIRSVQTLIEGDKLLLTYGAQDVSAEDSGAFTGEISGSMLAKLGCTFVVVGHSERRTLHSEDDAVVLAKTKAALKNGLTPIVCIGEGLNIREAGEHVAYNVAQLRGSLDGLSADDIAKVVIAYEPVWAIGTGRVASASDAQEVCGAIREELKELASAEVAAGVRVLYGGSVNAKNVGEIVGQPDVDGALVGGASLKADEFATLSAIAAGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Role of electrostatics in cold adaptation: A comparative study of eury- and stenopsychrophilic triose phosphate isomerase.
pubmed doi rcsb
molecule keywords Triosephosphate isomerase
molecule tags Isomerase
source organism Rhodococcus sp. jg-3
total genus 93
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 5.3.1.1: triose-phosphate isomerase.
pdb deposition date 2025-04-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...