9S3AA

Tagst-10 in complex with deoxynivalenol-13-glutathione
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
218
structure length
212
Chain Sequence
DEVKLLGMWASPFVLRVQLALSLKGVGYEYVEEDLKSKSELLLKSNPVLQKVPVLIHDGKPVCESSVILQYIDEAFAGVGPSLLPEEPHGRAVARFWAAYIDGTLVKASSQASMKAEGKKQVTAAVETLEGALRDCSNGKPFFGGDTAGYVDVMLGGLLAWVHAGDKMKGVKTFDPATTPLLAAWADNFGSLDAVEAVMPDVGKLVEFAMAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detoxification of deoxynivalenol by pathogen-inducible tau-class glutathione transferases from wheat.
pubmed doi rcsb
molecule keywords Glutathione S-transferase
molecule tags Transferase
source organism Triticum aestivum
total genus 69
structure length 212
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: glutathione transferase.
pdb deposition date 2025-07-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...