9UL1A

Crystal structure of tibetan wild boar sla-1*z0301 for 2.32 angstrom
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
276
structure length
276
Chain Sequence
MGPHSLRYFYTAVSRPDRGDSRFFIVGYVDDTQFVRFDSDAPNAKMEPRAQWIKQEGPEYWDRETQISKEAAQNYRGSLNNLRGYYNQSEAGSHTFQNMYGCYLGPDGLLLRGYHQFAYDGADYIALNEDLRSWTAADMAAQITKRKWKAAHEAERDRNYLQGTCVEWLQKYLEMGKDTLQRAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Tibetan wild boar SLA-1*Z0301 reveals conserved peptide presentation and potential high-altitude adaptation.
pubmed doi rcsb
molecule keywords MHC class I antigen
molecule tags Antiviral protein
source organism Sus scrofa
total genus 70
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2025-04-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...