9VF8A

Structure of meiothermus ruber mrub_1259 lov domain (mrlov)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
AGVVITDAQLPDYPIVYCNPGFVQLTGYPSEEVLGRNCRFLQGPATNPETVARLRRAIHEGRPAHVLLLNYRKDGQPFWNDLRIAPVRDVEGRLTHFVGIQSDVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of Meiothermus ruber LOV domains
rcsb
molecule keywords histidine kinase
molecule tags Fluorescent protein
source organism Meiothermus ruber dsm 1279
total genus 26
structure length 105
sequence length 105
ec nomenclature ec 2.7.13.3: histidine kinase.
pdb deposition date 2025-06-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...