9Y02A

Qatb-qatc complex in qatabcd anti-phage defense with atp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
224
structure length
211
Chain Sequence
GSLRGARSSFTRFARTGSSSDLGNALSSYVRKGVGGSSRGARRMGASRAAAAKLLSIFGDVQRNGAAETLRRLQLTVAPGQPASQVLLSLLEFICPPGGAIDEGVARQAALNTIAELDEAGGGSFEDMTQVDRQNFFLDFVANSIESMIMADLGERIQSQLSSFITGCTRGQLANRLEQWPAPTDQEVNQVTSAIYEAAFDLIATAAEGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of QueC-family protein function in qatABCD anti-phage defense.
pubmed doi rcsb
molecule keywords QatB
molecule tags Antiviral protein
source organism Pseudomonas aeruginosa
total genus 94
structure length 211
sequence length 224
ec nomenclature
pdb deposition date 2025-08-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...