The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
75
|
structure length |
75
|
Chain Sequence |
MSIWKEAKDASGRIYYYNTLTKKSTWEKPKELISQEELLLRENGWKAAKTADGKVYYYNPTTRETSWTIPAFEKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Nuclear protein
|
| molecule keywords |
PRE-MRNA PROCESSING PROTEIN PRP40
|
| publication title |
Solution Structure and Ligand Recognition of the Ww Domain Pair of the Yeast Splicing Factor Prp40
pubmed doi rcsb |
| source organism |
Saccharomyces cerevisiae
|
| total genus |
9
|
| structure length |
75
|
| sequence length |
75
|
| ec nomenclature | |
| pdb deposition date | 2002-10-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00397 | WW | WW domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Single Sheet | Ubiquitin Ligase Nedd4; Chain: W; | Ubiquitin Ligase Nedd4; Chain: W; | ||
| Mainly Beta | Single Sheet | Ubiquitin Ligase Nedd4; Chain: W; | Ubiquitin Ligase Nedd4; Chain: W; |
#chains in the Genus database with same CATH superfamily 1NMV A; 2YSI A; 1PIN A; 2XPB A; 2XP4 A; 2XP8 A; 3KAH A; 3M85 A; 1YW5 A; 4QIB A; 2LAJ A; 2F21 A; 2KXQ A; 2DMV A; 3TC5 A; 2ZQS A; 2Q5A A; 1K9R A; 2DWV A; 2ZQV A; 2E45 A; 4U84 A; 2M3O W; 3OOB A; 2ZR4 A; 4U85 A; 3KAG A; 3TDB A; 1EG3 A; 1WR7 A; 2YSF A; 2L4J A; 2ZR6 A; 3KAD A; 2XP7 A; 3NTP A; 1EG4 A; 2DJY A; 2JV4 A; 2XP9 A; 5CQ2 A; 3KAI A; 2YSB A; 3LE4 A; 2YSH A; 2JX8 A; 2XPA A; 2XP6 A; 1TK7 A; 1K9Q A; 2ZQT A; 2EZ5 W; 1I5H W; 2JXW A; 2MDI A; 3CNG A; 2BA1 A; 1ZCN A; 3WH0 A; 4REX A; 3TCZ A; 2XP5 A; 2ZAJ A; 5AHT A; 2XP3 A; 3KAF A; 3KCE A; 2YSG A; 2ITK A; 2DK1 A; 2ZQU A; 4U86 A; 2ZR5 A; 2DK7 A; 3L4H A; 2JMF A; 3ODK A; 3KAB A; 1JMQ A; 4E5R A; 1WMV A; 1O6W A; 2M8J A; 1F8A B; 3M7N A; 2RE3 A; 2M8I A; #chains in the Genus database with same CATH topology 1NMV A; 4A0T A; 2YSI A; 1PIN A; 2XPB A; 2XP4 A; 2XP8 A; 3KAH A; 1RP5 A; 1YW5 A; 1TR8 A; 4QIB A; 3M85 A; 3FSC A; 2LAJ A; 2F21 A; 2WAD A; 3MQH A; 2KXQ A; 2OWO A; 2DMV A; 3TC5 A; 2ZQS A; 2Q5A A; 1K9R A; 2DWV A; 5E64 A; 2ZQV A; 2E45 A; 3MCB B; 4U84 A; 2M3O W; 3OOB A; 2YAJ B; 2ZR4 A; 5E66 A; 4U85 A; 3KAG A; 3TDB A; 3MCB A; 1EG3 A; 1WR7 A; 2YSF A; 2L4J A; 2ZR6 A; 3KAD A; 2XP7 A; 3NTP A; 1EG4 A; 2DJY A; 2WAE A; 3FS8 A; 2JV4 A; 2XP9 A; 5CQ2 A; 3KAI A; 2YSB A; 3LE4 A; 2YSH A; 2JX8 A; 2XPA A; 4A0U A; 2XP6 A; 1TK7 A; 1K9Q A; 2ZQT A; 3MQG A; 3FSB A; 1FLC A; 4GLX A; 3LKX B; 2EZ5 W; 1I5H W; 2JXW A; 2MDI A; 5E62 A; 2QRV A; 3CNG A; 5U47 A; 2BA1 A; 3LKX A; 1ZCN A; 3WH0 A; 4REX A; 3TCZ A; 5E65 A; 2XP5 A; 2ZAJ A; 5AHT A; 2XP3 A; 2Y8N B; 3KAF A; 3KCE A; 2YSG A; 2ITK A; 2DK1 A; 2ZQU A; 4U86 A; 5E5W A; 2ZR5 A; 2DK7 A; 3L4H A; 2JMF A; 3ODK A; 3KAB A; 1JMQ A; 3PQH A; 4E5R A; 1WMV A; 1O6W A; 2M8J A; 1F8A B; 3M7N A; 2RE3 A; 2M8I A; #chains in the Genus database with same CATH homology 1NMV A; 4A0T A; 2YSI A; 1PIN A; 2XPB A; 2XP4 A; 2XP8 A; 3KAH A; 1RP5 A; 1YW5 A; 1TR8 A; 4QIB A; 3M85 A; 3FSC A; 2LAJ A; 2F21 A; 2WAD A; 3MQH A; 2KXQ A; 2OWO A; 2DMV A; 3TC5 A; 2ZQS A; 2Q5A A; 1K9R A; 2DWV A; 5E64 A; 2ZQV A; 2E45 A; 3MCB B; 4U84 A; 2M3O W; 3OOB A; 2YAJ B; 2ZR4 A; 5E66 A; 4U85 A; 3KAG A; 3TDB A; 3MCB A; 1EG3 A; 1WR7 A; 2YSF A; 2L4J A; 2ZR6 A; 3KAD A; 2XP7 A; 3NTP A; 1EG4 A; 2DJY A; 2WAE A; 3FS8 A; 2JV4 A; 2XP9 A; 5CQ2 A; 3KAI A; 2YSB A; 3LE4 A; 2YSH A; 2JX8 A; 2XPA A; 4A0U A; 2XP6 A; 1TK7 A; 1K9Q A; 2ZQT A; 3MQG A; 3FSB A; 1FLC A; 4GLX A; 3LKX B; 2EZ5 W; 1I5H W; 2JXW A; 2MDI A; 5E62 A; 2QRV A; 3CNG A; 5U47 A; 2BA1 A; 3LKX A; 1ZCN A; 3WH0 A; 4REX A; 3TCZ A; 5E65 A; 2XP5 A; 2ZAJ A; 5AHT A; 2XP3 A; 2Y8N B; 3KAF A; 3KCE A; 2YSG A; 2ITK A; 2DK1 A; 2ZQU A; 4U86 A; 5E5W A; 2ZR5 A; 2DK7 A; 3L4H A; 2JMF A; 3ODK A; 3KAB A; 1JMQ A; 3PQH A; 4E5R A; 1WMV A; 1O6W A; 2M8J A; 1F8A B; 3M7N A; 2RE3 A; 2M8I A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
