The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
50
|
sequence length |
168
|
structure length |
168
|
Chain Sequence |
MTLEDDLNATNEYYRERGIAVIHKKPTPVQIVRVDYPKRSAAVITEAYFRQASTTDYNGVYRGKYIDFEAKETKNKTAFPLKNFHAHQIRHMEQVVAHGGICFAILRFSLLNETYLLDASHLIAWWNKQEAGGRKSIPKQEIERHGHSIPLGYQPRLDYISVVDNVYF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Recombination
|
| molecule keywords |
Penicillin-binding protein-related factor A
|
| publication title |
X-ray crystal Structure of Penicillin-binding protein-related factor A from Bacillus stearothermophilus
rcsb |
| source organism |
Geobacillus stearothermophilus
|
| total genus |
50
|
| structure length |
168
|
| sequence length |
168
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
3.1.22.4: Crossover junction endodeoxyribonuclease. |
| pdb deposition date | 2004-11-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03838 | RecU | Recombination protein U |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Trna Endonuclease; Chain: A, domain 1 | Trna Endonuclease; Chain: A, domain 1 |
#chains in the Genus database with same CATH superfamily 1R0V A; 2INB A; 3DNX A; 1XMX A; 1RZN A; 1OB9 A; 2WJ0 A; 3IEY A; 2VLD A; 2FCO A; 2GJW A; 1Y1O A; 1HH1 A; 2OST A; 4QBL A; 1A79 A; 2CV8 A; 2WCW A; 1GEF A; 1T0F A; 1R11 A; 2WIZ A; 2WCZ A; 3AJV B; 2GW6 A; 4TKK A; 2EO0 A; 3FOV A; 3P1Y A; 4QBO A; 3AJV A; 4QBN A; 4TKD A; 1IPI A; 3P1Z B; 1OB8 A; 1ZP7 A; 1RLV A; 2ZYZ B; 2WIW A; 2OKF A; 3P1Z A; 5FDK A; 1Y88 A; 1F1Z A; 2ZYZ A; #chains in the Genus database with same CATH topology 3BT7 A; 1R0V A; 3IEY B; 1YNM A; 2INB A; 2W8M A; 3DNX A; 2BH2 A; 1XMX A; 1RZN A; 1OB9 A; 2WJ0 A; 3IEY A; 2VLD A; 2FCO A; 3IF0 X; 4DAP A; 2GJW A; 1Y1O A; 1HH1 A; 2OST A; 2FKH B; 4QBL A; 1A79 A; 2CV8 A; 4G6V A; 4ZQU A; 2WCW A; 1GEF A; 1T0F A; 2CZR A; 1R11 A; 2VS1 A; 2WIZ A; 2Z0R A; 2IXS A; 2WCZ A; 3AJV B; 4DA2 A; 2DBS A; 2GW6 A; 4TKK A; 4G6U A; 2EO0 A; 3FOV A; 2FL3 A; 3P1Y A; 4QBO A; 4DAV A; 3AJV A; 4QBN A; 4TKD A; 2JJQ A; 1IPI A; 2FLC A; 3P1Z B; 1OB8 A; 1ZP7 A; 2FKC A; 1RLV A; 2ZYZ B; 1UWV A; 2WIW A; 4E6Z A; 4EV1 A; 2OKF A; 3P1Z A; 4LQE A; 5FDK A; 1Y88 A; 1F1Z A; 2ZYZ A; #chains in the Genus database with same CATH homology 3BT7 A; 1R0V A; 3IEY B; 1YNM A; 2INB A; 2W8M A; 3DNX A; 2BH2 A; 1XMX A; 1RZN A; 1OB9 A; 2WJ0 A; 3IEY A; 2VLD A; 2FCO A; 3IF0 X; 4DAP A; 2GJW A; 1Y1O A; 1HH1 A; 2OST A; 2FKH B; 4QBL A; 1A79 A; 2CV8 A; 4G6V A; 4ZQU A; 2WCW A; 1GEF A; 1T0F A; 2CZR A; 1R11 A; 2VS1 A; 2WIZ A; 2Z0R A; 2IXS A; 2WCZ A; 3AJV B; 4DA2 A; 2DBS A; 2GW6 A; 4TKK A; 4G6U A; 2EO0 A; 3FOV A; 2FL3 A; 3P1Y A; 4QBO A; 4DAV A; 3AJV A; 4QBN A; 4TKD A; 2JJQ A; 1IPI A; 2FLC A; 3P1Z B; 1OB8 A; 1ZP7 A; 2FKC A; 1RLV A; 2ZYZ B; 1UWV A; 2WIW A; 4E6Z A; 4EV1 A; 2OKF A; 3P1Z A; 4LQE A; 5FDK A; 1Y88 A; 1F1Z A; 2ZYZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
