The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
83
|
structure length |
83
|
Chain Sequence |
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
SAV1430
|
publication title |
Crystal Structure of the Hypothetical Protein SAV1430 from Staphylococcus aureus, Northeast Structural Genomics ZR18.
rcsb |
source organism |
Staphylococcus aureus subsp. aureus mu50
|
total genus |
15
|
structure length |
83
|
sequence length |
83
|
ec nomenclature | |
pdb deposition date | 2005-12-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08712 | Nfu_N | Scaffold protein Nfu/NifU N terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Ribosomal Protein S8; Chain: A, domain 1 | Scaffold protein Nfu/NifU, N-terminal domain |
#chains in the Genus database with same CATH superfamily 1PQX A; 2M8W A; 2LTM A; 2LTL A; 2M6Q A; 2K1H A; 2FFM A; #chains in the Genus database with same CATH topology 1WHR A; 2CWF A; 1Z2I A; 4NZR M; 4PDB A; 3V69 A; 2FPH X; 1J5K A; 2CTE A; 2M6Q A; 1XMO H; 4LFC H; 3U1K A; 2F4V H; 3EZJ A; 1ZZI A; 2JEB I; 3GR5 A; 2ZQE A; 2UXD H; 5A2Q W; 2CTJ A; 1PQX A; 4B3M H; 5BR8 H; 4YY3 H; 2CTF A; 4DV3 H; 2MJH A; 5LMU H; 4BA2 I; 4JI2 H; 2CPM A; 1HNZ H; 5C0X G; 2LRR A; 4EC5 A; 4JI3 H; 4IFD G; 2AXY A; 1VBI A; 2OPU A; 1XNQ H; 2BA0 A; 1MSZ A; 1X4N A; 1DTJ A; 3UOE A; 2LTL A; 4X62 H; 1DT4 A; 2UXB H; 1S20 A; 1N33 H; 1X9Z A; 1WVN A; 2M8W A; 4X65 H; 4B3S H; 4NXN H; 4LFB H; 3SB1 A; 4KHP H; 3OSS D; 2UU9 H; 4BA1 I; 1XMQ H; 3T1H H; 1I6U A; 2Y3M A; 1WE8 A; 1N34 H; 2UUC H; 4LF9 H; 4JYA H; 4DV4 H; 1WTJ A; 2NN6 G; 4OCH A; 4DR3 H; 3J81 W; 2CTK A; 1ZZK A; 4LF7 H; 1IBL H; 1F0X A; 3GKU A; 1NXU A; 3J80 W; 4DV0 H; 2PT7 G; 1XRH A; 2O4C A; 3OTO H; 2CTM A; 5JEA G; 3OET A; 4LF6 H; 1FJG H; 4DR7 H; 2PY9 A; 2G8Y A; 4G08 A; 1SEI A; 2CPQ A; 4OX9 H; 4DR6 H; 2HH3 A; 4B8C D; 2YQR A; 3T1Y H; 4QMF B; 2UUB H; 4AM3 A; 2VQE H; 4JV5 H; 4DV6 H; 4X66 H; 4DR5 H; 5K36 G; 2K1H A; 4H8A A; 1J4W A; 2P2R A; 2LF0 A; 4NBQ A; 2ANN A; 2CWH A; 1AN7 A; 1UG8 A; 1IBM H; 2E3U A; 4DV1 H; 1HNX H; 1X4M A; 1VIH A; 4LF4 H; 4NXM H; 2UUA H; 4E9J A; 4JI7 H; 4DUY H; 3RF2 A; 2OPV A; 2QND A; 4LF5 H; 3VKE A; 2VKC A; 1V8C A; 1S03 G; 4GKJ H; 5FLX W; 4DUZ H; 4AQY H; 2HH2 A; 3QD7 X; 1N36 H; 1HNW H; 4FJU A; 3J7A K; 1EC6 A; 3KDG A; 4B3T H; 4JI8 H; 3KDK A; 4DR1 H; 1FKA H; 4LFA H; 5DT9 A; 2JA9 A; 2ZM6 H; 3I0P A; 4LF8 H; 5IT9 W; 2UXC H; 4DR4 H; 1IBK H; 1V9N A; 4DV2 H; 4DV5 H; 2DGR A; 4JI4 H; 1XNR H; 1I94 H; 2D9I A; 2JZX A; 4JI1 H; 3NCV A; 4WAL A; 1X0A A; 4OO1 G; 5LL6 b; 1ZTG A; 2A1S A; 4JVY A; 2Z0S A; 2JE6 I; 4K0K H; 1KHM A; 3JAM W; 3GAB A; 4YHH H; 4B8T A; 4B3R H; 2FMR A; 1ODH A; 2LTM A; 5LMN H; 3AEV B; 1TUA A; 4FJS A; 4AIM A; 4JVH A; 4X64 H; 2X06 A; 4DV7 H; 3L7Z C; 4LIJ A; 2VQF H; 4JI6 H; 2E5L H; 2HHH H; 1K1G A; 2JEA I; 1HR0 H; 4NZT M; 4DR2 H; 1VIG A; 5IWA H; 1J5E H; 2JVZ A; 4WAN A; 4OD6 A; 1N32 H; 3FAU A; 4JI0 H; 4GKK H; 2CTL A; 2FFM A; 2PQU A; 2BL5 A; 2ANR A; 1ZZJ A; 4JI5 H; #chains in the Genus database with same CATH homology 1PQX A; 2M8W A; 2LTM A; 2LTL A; 2M6Q A; 2K1H A; 2FFM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...