The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
182
|
structure length |
182
|
Chain Sequence |
APITLWTGPGPSINGFINDTPVIRCFICLTRDSNLVTVNASFVGEGGYRIVSPTQSQFSLIMEFDQFGQLMSTGNINSTTTWGEKPWGNNTVQPRPSHTWKLCMPNREVYSTPAATISRCGLDSIAVDGAPSRSIDCMLIINKPKGVATYTLTFRFLNFNRLSGGTLFKTDVLTFTYVGENQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Viral protein
|
molecule keywords |
FIBER PROTEIN
|
publication title |
Structural and Mutational Analysis of Human Ad37 and Canine Adenovirus 2 Fiber Heads in Complex with the D1 Domain of Coxsackie and Adenovirus Receptor.
pubmed doi rcsb |
source organism |
Canine adenovirus 2
|
total genus |
38
|
structure length |
182
|
sequence length |
182
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature | |
pdb deposition date | 2006-08-16 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Adenovirus Type 5 Fiber Protein (Receptor Binding Domain) | Adenovirus pIV-related, attachment domain |
#chains in the Genus database with same CATH superfamily 1UXB A; 1P6A A; 2QLK A; 2WST A; 2J2J A; 2WGU A; 1KNB A; 2J12 A; 3N0I A; 1QIU A; 4XQA A; 2WBW A; 1QHV A; 2WGT A; 3EXV A; 1P69 A; 4XQB A; 3CNC A; 1KAC A; 4K6W A; 1NOB A; 1UXE A; 1H7Z A; 1UXA A; 3QND A; 3L89 A; 4ATZ A; 4K6V A; 2BZV A; 3BQ4 A; 2W9L C; 4WYJ A; 2BZU A; 3EXW A; 2WBV A; 2O39 A; 3L88 A; 4K6T A; 2J1K C; 4ZDG A; 4XL8 A; 3O8E A; 4K6U A; 4LIY A; 3F0Y A; #chains in the Genus database with same CATH topology 1UXB A; 1P6A A; 2QLK A; 2WST A; 2VTW A; 2J2J A; 2WGU A; 1KNB A; 2J12 A; 3N0I A; 4ODB A; 1QIU A; 4XQA A; 2WBW A; 1QHV A; 2WGT A; 3S6X A; 1KKE A; 3EXV A; 1P69 A; 4D62 A; 5MHS A; 4XQB A; 2JJL A; 1KAC A; 3CNC A; 1NOB A; 4K6W A; 1UXE A; 1H7Z A; 2BSF A; 1UXA A; 3ZPF A; 2IUM A; 3QND A; 2BT7 A; 3L89 A; 3EOY A; 4ATZ A; 4K6V A; 2BZV A; 4GU3 A; 2VRS A; 3BQ4 A; 2W9L C; 4WYJ A; 4D63 A; 2BZU A; 3EXW A; 2WBV A; 2O39 A; 3L88 A; 4CW8 A; 4K6T A; 2J1K C; 2OJ6 A; 4XC5 A; 2BT8 A; 3O8E A; 4XL8 A; 4ZDG A; 4K6U A; 4LIY A; 2IUN A; 3F0Y A; 3ZPE A; 2OJ5 A; 4GU4 A; #chains in the Genus database with same CATH homology 1UXB A; 1P6A A; 2QLK A; 2WST A; 2J2J A; 2WGU A; 1KNB A; 2J12 A; 3N0I A; 1QIU A; 4XQA A; 2WBW A; 1QHV A; 2WGT A; 3EXV A; 1P69 A; 4XQB A; 3CNC A; 1KAC A; 4K6W A; 1NOB A; 1UXE A; 1H7Z A; 1UXA A; 3QND A; 3L89 A; 4ATZ A; 4K6V A; 2BZV A; 3BQ4 A; 2W9L C; 4WYJ A; 2BZU A; 3EXW A; 2WBV A; 2O39 A; 3L88 A; 4K6T A; 2J1K C; 4ZDG A; 4XL8 A; 3O8E A; 4K6U A; 4LIY A; 3F0Y A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...