The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
44
|
sequence length |
185
|
structure length |
185
|
Chain Sequence |
YDTRTLWTTPDTSPNCTIAQDKDSKLTLVLTKCGSQILANVSLIVVAGKYHIINNKTNPKIKSFTIKLLFNKNGVLLDNSNLGKAYWNFRSGNSNVSTAYEKAIGFMPNLVAYPKPSNSKKYARDIVYGTIYLGGKPDQPAVIKTTFNQETGCEYSITFNFSWSKTYENVEFETTSFTFSYIAQE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Viral protein
|
molecule keywords |
FIBER PROTEIN
|
publication title |
Design, Synthesis, and Evaluation of N-Acyl Modified Sialic Acids as Inhibitors of Adenoviruses Causing Epidemic Keratoconjunctivitis.
pubmed doi rcsb |
source organism |
Human adenovirus 37
|
total genus |
44
|
structure length |
185
|
sequence length |
185
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2009-04-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00541 | Adeno_knob | Adenoviral fibre protein (knob domain) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Adenovirus Type 5 Fiber Protein (Receptor Binding Domain) | Adenovirus pIV-related, attachment domain |
#chains in the Genus database with same CATH superfamily 2WGU A; 1KAC A; 4K6W A; 4XL8 A; 1KNB A; 3L89 A; 4K6T A; 1UXA A; 4LIY A; 3F0Y A; 3BQ4 A; 2WGT A; 4XQB A; 2BZV A; 4WYJ A; 1UXE A; 2WST A; 1NOB A; 1QHV A; 4ATZ A; 4K6U A; 4K6V A; 2J1K C; 3O8E A; 2O39 A; 2QLK A; 3EXV A; 3QND A; 2WBW A; 3L88 A; 1P6A A; 1UXB A; 2J2J A; 2W9L C; 3CNC A; 3EXW A; 4XQA A; 3N0I A; 1H7Z A; 1QIU A; 1P69 A; 4ZDG A; 2WBV A; 2BZU A; 2J12 A; #chains in the Genus database with same CATH topology 2BT7 A; 2WGU A; 1KAC A; 4K6W A; 4XL8 A; 1KNB A; 3L89 A; 3ZPE A; 4GU3 A; 4K6T A; 4CW8 A; 1UXA A; 4LIY A; 3F0Y A; 3ZPF A; 2OJ5 A; 3BQ4 A; 2WGT A; 4XQB A; 2BZV A; 4WYJ A; 2JJL A; 1UXE A; 2VTW A; 1NOB A; 1QHV A; 2WST A; 4ATZ A; 4K6U A; 4K6V A; 2J1K C; 2OJ6 A; 3O8E A; 3EOY A; 2O39 A; 2QLK A; 2IUM A; 4GU4 A; 3EXV A; 3QND A; 2WBW A; 3L88 A; 4D62 A; 2BSF A; 1P6A A; 1UXB A; 2J2J A; 2W9L C; 3CNC A; 3EXW A; 4ODB A; 3N0I A; 1H7Z A; 1QIU A; 1P69 A; 2IUN A; 2VRS A; 4XQA A; 4XC5 A; 2BT8 A; 4ZDG A; 3S6X A; 2WBV A; 1KKE A; 5MHS A; 2BZU A; 2J12 A; 4D63 A; #chains in the Genus database with same CATH homology 2WGU A; 1KAC A; 4K6W A; 4XL8 A; 1KNB A; 3L89 A; 4K6T A; 1UXA A; 4LIY A; 3F0Y A; 3BQ4 A; 2WGT A; 4XQB A; 2BZV A; 4WYJ A; 1UXE A; 2WST A; 1NOB A; 1QHV A; 4ATZ A; 4K6U A; 4K6V A; 2J1K C; 3O8E A; 2O39 A; 2QLK A; 3EXV A; 3QND A; 2WBW A; 3L88 A; 1P6A A; 1UXB A; 2J2J A; 2W9L C; 3CNC A; 3EXW A; 4XQA A; 3N0I A; 1H7Z A; 1QIU A; 1P69 A; 4ZDG A; 2WBV A; 2BZU A; 2J12 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...