The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
6
|
sequence length |
67
|
structure length |
67
|
Chain Sequence |
MTIQAPETKIVDKSRVACDGGEGALGHPRVWLQIPEDTGWVECPYCDCKYVLKGSKADALEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Uncharacterized protein
|
publication title |
Solution NMR Structure of Q5LLS5 from Silicibacter pomeroyi.
rcsb |
source organism |
Silicibacter pomeroyi
|
total genus |
6
|
structure length |
67
|
sequence length |
67
|
ec nomenclature | |
pdb deposition date | 2007-06-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF10276 | zf-CHCC | Zinc-finger domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | HSP40/DNAj peptide-binding domain | q5lls5 like domains |
#chains in the Genus database with same CATH superfamily 2ODX A; 2JRR A; 2JZ8 A; 2JVM A; #chains in the Genus database with same CATH topology 3TJ8 A; 3C6E C; 1GMW D; 2QLD A; 2JZ8 A; 3LZ8 A; 3AKO B; 2JVM A; 1GMU A; 3TJ9 A; 4J80 A; 1XAO A; 3C5X C; 3L9Z A; 3AGZ A; 1C3G A; 1EAR A; 3TJA A; 4L3K A; 1GMW A; 3AGX A; 2ODX A; 3AGY A; 1EB0 A; 3NXZ A; 2JRR A; 3NY0 A; 2B26 A; 2Q2G A; 3LA0 A; 1NLT A; 1GMV A; 3I38 A; #chains in the Genus database with same CATH homology 2ODX A; 2JRR A; 2JZ8 A; 2JVM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...