2OGHA

Solution structure of yeast eif1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
108
structure length
108
Chain Sequence
MSIENLKSFDPFADTGDDETATSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQGDQRAKVCEFMISQLGLQKKNIKIHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor eIF-1
publication title Eukaryotic Initiation Factor (eIF) 1 Carries Two Distinct eIF5-binding Faces Important for Multifactor Assembly and AUG Selection.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01253 SUI1 Translation initiation factor SUI1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.780.10 Alpha Beta 2-Layer Sandwich Translation Initiation Factor Eif1 SUI1-like domain 2oghA01
2IF1A 3J81m 4MO0A 3J80j 3JAMj 1D1RA 2RVHA 2OGHA 4V1Al 3J7Yg
chains in the Genus database with same CATH superfamily
2IF1A 3J81m 2KX2A 4MO0A 3J80j 3JAMj 1D1RA 2RVHA 2OGHA 2OCAA 4V1Al 3J7Yg 1RIFA
chains in the Genus database with same CATH topology
2IF1A 3J81m 4MO0A 3J80j 3JAMj 1D1RA 2RVHA 2OGHA 4V1Al 3J7Yg
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IF1 A;  3J81 m;  4MO0 A;  3J80 j;  3JAM j;  1D1R A;  2RVH A;  2OGH A;  4V1A l;  3J7Y g; 
#chains in the Genus database with same CATH topology
 2IF1 A;  3J81 m;  2KX2 A;  4MO0 A;  3J80 j;  3JAM j;  1D1R A;  2RVH A;  2OGH A;  2OCA A;  4V1A l;  3J7Y g;  1RIF A; 
#chains in the Genus database with same CATH homology
 2IF1 A;  3J81 m;  4MO0 A;  3J80 j;  3JAM j;  1D1R A;  2RVH A;  2OGH A;  4V1A l;  3J7Y g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...