3J7Yg

Structure of the large ribosomal subunit from human mitochondria
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
129
structure length
129
Chain Sequence
FVESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
total genus 19
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF05046 Img2 Mitochondrial large subunit ribosomal protein (Img2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.780.10 Alpha Beta 2-Layer Sandwich Translation Initiation Factor Eif1 SUI1-like domain 3j7yg00
4V1Al 2IF1A 2RVHA 3JAMj 3J81m 3J80j 4MO0A 3J7Yg 2OGHA 1D1RA
chains in the Genus database with same CATH superfamily
2KX2A 4V1Al 2OCAA 1RIFA 2IF1A 2RVHA 3JAMj 3J81m 3J80j 4MO0A 3J7Yg 2OGHA 1D1RA
chains in the Genus database with same CATH topology
4V1Al 2IF1A 2RVHA 3JAMj 3J81m 3J80j 4MO0A 3J7Yg 2OGHA 1D1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1A l;  2IF1 A;  2RVH A;  3JAM j;  3J81 m;  3J80 j;  4MO0 A;  3J7Y g;  2OGH A;  1D1R A; 
#chains in the Genus database with same CATH topology
 2KX2 A;  4V1A l;  2OCA A;  1RIF A;  2IF1 A;  2RVH A;  3JAM j;  3J81 m;  3J80 j;  4MO0 A;  3J7Y g;  2OGH A;  1D1R A; 
#chains in the Genus database with same CATH homology
 4V1A l;  2IF1 A;  2RVH A;  3JAM j;  3J81 m;  3J80 j;  4MO0 A;  3J7Y g;  2OGH A;  1D1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...