4MO0A

Crystal structure of aif1 from methanocaldococcus jannaschii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
EQKIKIYVTKRRFGKLMTIIEGFDTSVIDLKELAKKLKDICACGGTVKDNTIELQGDHRKKVAEELVKMGFSRDSIEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Protein translation factor SUI1 homolog
publication title Crystal structure of aIF1 from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
total genus 23
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01253 SUI1 Translation initiation factor SUI1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.780.10 Alpha Beta 2-Layer Sandwich Translation Initiation Factor Eif1 SUI1-like domain 4mo0A00
2RVHA 4V1Al 3J80j 3J7Yg 2OGHA 4MO0A 1D1RA 3J81m 2IF1A 3JAMj
chains in the Genus database with same CATH superfamily
2RVHA 2OCAA 4V1Al 3J80j 3J7Yg 2OGHA 4MO0A 2KX2A 1D1RA 3J81m 2IF1A 1RIFA 3JAMj
chains in the Genus database with same CATH topology
2RVHA 4V1Al 3J80j 3J7Yg 2OGHA 4MO0A 1D1RA 3J81m 2IF1A 3JAMj
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVH A;  4V1A l;  3J80 j;  3J7Y g;  2OGH A;  4MO0 A;  1D1R A;  3J81 m;  2IF1 A;  3JAM j; 
#chains in the Genus database with same CATH topology
 2RVH A;  2OCA A;  4V1A l;  3J80 j;  3J7Y g;  2OGH A;  4MO0 A;  2KX2 A;  1D1R A;  3J81 m;  2IF1 A;  1RIF A;  3JAM j; 
#chains in the Genus database with same CATH homology
 2RVH A;  4V1A l;  3J80 j;  3J7Y g;  2OGH A;  4MO0 A;  1D1R A;  3J81 m;  2IF1 A;  3JAM j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...