The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
90
|
structure length |
90
|
Chain Sequence |
ETATSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQGDQRAKVCEFMISQLGLQKKNIKIHGF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Ribosome
|
| molecule keywords |
18S rRNA
|
| publication title |
Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb |
| source organism |
Saccharomyces cerevisiae
|
| total genus |
16
|
| structure length |
90
|
| sequence length |
90
|
| ec nomenclature | |
| pdb deposition date | 2014-08-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| m | PF01253 | SUI1 | Translation initiation factor SUI1 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor Eif1 | SUI1-like domain |
#chains in the Genus database with same CATH superfamily 2RVH A; 3J81 m; 2IF1 A; 3JAM j; 4MO0 A; 3J7Y g; 1D1R A; 2OGH A; 3J80 j; 4V1A l; #chains in the Genus database with same CATH topology 2RVH A; 3J81 m; 2IF1 A; 2OCA A; 3JAM j; 4MO0 A; 3J7Y g; 1D1R A; 2OGH A; 1RIF A; 3J80 j; 4V1A l; 2KX2 A; #chains in the Genus database with same CATH homology 2RVH A; 3J81 m; 2IF1 A; 3JAM j; 4MO0 A; 3J7Y g; 1D1R A; 2OGH A; 3J80 j; 4V1A l;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
