The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
80
|
structure length |
80
|
Chain Sequence |
GSQVDAEGNPFWEISDKRRVGISQFKKMDFINIREYYEAGGEMKPGKKGIGLTVDQYTAFLKAIPAINAELRSRGHDITD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription
|
molecule keywords |
MOSUB1, TRANSCRIPTION COFACTOR
|
publication title |
Structural Features of the Single-Stranded DNA-Binding Protein Mosub1 from Magnaporthe Oryzae.
pubmed doi rcsb |
source organism |
Magnaporthe oryzae
|
total genus |
14
|
structure length |
80
|
sequence length |
80
|
ec nomenclature | |
pdb deposition date | 2012-01-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02229 | PC4 | Transcriptional Coactivator p15 (PC4) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | Transcriptional Co-activator pc4; Chain A | Transcriptional Coactivator Pc4; Chain A |
#chains in the Genus database with same CATH superfamily 4KOQ A; 2NVN A; 4KOO A; 4KOP A; 3R9Y A; 3N1H A; 3N1I A; 3N1L A; 2IT9 A; 4BHM A; 1L3A A; 4USG A; 3RA0 A; 4AGH A; 3R9Z A; 4BG7 A; 1PCF A; 3N1K A; 2C62 A; 3N1J A; 2PHE A; #chains in the Genus database with same CATH topology 2GJE D; 4J38 A; 4KOQ A; 2NVN A; 3CM1 A; 4KOO A; 4KOP A; 3R9Y A; 3N1H A; 4BF3 A; 3N1I A; 3N1L A; 2IT9 A; 2M4F A; 2GID A; 2GIA A; 4BXM A; 4BHM A; 1L3A A; 4USG A; 4BOB A; 3RA0 A; 5FGP A; 4AGH A; 2GID B; 2GIA B; 3R9Z A; 4BG7 A; 4BOD A; 1PCF A; 3N1K A; 2GJE A; 2C62 A; 3MTV A; 3N1J A; 2PHE A; 3K44 A; 3OBH A; #chains in the Genus database with same CATH homology 4KOQ A; 2NVN A; 4KOO A; 4KOP A; 3R9Y A; 3N1H A; 3N1I A; 3N1L A; 2IT9 A; 4BHM A; 1L3A A; 4USG A; 3RA0 A; 4AGH A; 3R9Z A; 4BG7 A; 1PCF A; 3N1K A; 2C62 A; 3N1J A; 2PHE A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...