The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
79
|
structure length |
79
|
Chain Sequence |
GSQVDAEGNPFWEISDKRRVGISQFKKMDFINIREYYEAGGEMKPGKKGIGLTVDQYTAFLKAIPAINAELRSRGHDIT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Transcription/dna
|
| molecule keywords |
MOSUB1 TRANSCRIPTION COFACTOR
|
| publication title |
Substitution of Tryptophan 89 with Tyrosine Switches the DNA Binding Mode of Pc4.
pubmed doi rcsb |
| source organism |
Magnaporthe oryzae
|
| total genus |
17
|
| structure length |
79
|
| sequence length |
79
|
| chains with identical sequence |
B, C, D, E, F
|
| ec nomenclature | |
| pdb deposition date | 2013-04-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02229 | PC4 | Transcriptional Coactivator p15 (PC4) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | Transcriptional Co-activator pc4; Chain A | Transcriptional Coactivator Pc4; Chain A |
#chains in the Genus database with same CATH superfamily 3R9Z A; 4KOQ A; 4AGH A; 3RA0 A; 3N1L A; 2IT9 A; 3N1H A; 3N1K A; 3R9Y A; 1L3A A; 4KOO A; 2NVN A; 3N1I A; 4USG A; 4KOP A; 4BG7 A; 3N1J A; 2PHE A; 4BHM A; 1PCF A; 2C62 A; #chains in the Genus database with same CATH topology 5FGP A; 3R9Z A; 4KOQ A; 4AGH A; 4BOD A; 3RA0 A; 3OBH A; 3MTV A; 3N1L A; 2IT9 A; 3N1H A; 3N1K A; 2GID A; 3R9Y A; 4BOB A; 2GJE D; 2M4F A; 1L3A A; 4KOO A; 2NVN A; 2GJE A; 4J38 A; 2GIA A; 4USG A; 3N1I A; 4KOP A; 2GID B; 3CM1 A; 4BG7 A; 4BXM A; 3K44 A; 3N1J A; 2PHE A; 4BHM A; 2GIA B; 4BF3 A; 1PCF A; 2C62 A; #chains in the Genus database with same CATH homology 3R9Z A; 4KOQ A; 4AGH A; 3RA0 A; 3N1L A; 2IT9 A; 3N1H A; 3N1K A; 3R9Y A; 1L3A A; 4KOO A; 2NVN A; 3N1I A; 4USG A; 4KOP A; 4BG7 A; 3N1J A; 2PHE A; 4BHM A; 1PCF A; 2C62 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
