The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
57
|
sequence length |
227
|
structure length |
227
|
Chain Sequence |
HHHGKIYSFDTLANADLIIDAVYEGGSSGNASDDPISKIIKGIGNMGGFRSAGQGIFKKLIVLYTNMEDGDWPDSIDTSKGQFIYYGDNKHPGHDIHDTPRQGNATLKMLFDSTHNEKDARRIVPPIFIFVKYPTASSSRSVQFKGVAVPGYPGLSATDDLIAVWKTTNGQRFQNYRAIFTILNIPMVSRKWINSLFDPFGQDNSLNPFYQWKISGKADVLIAPSTK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Dna binding protein
|
molecule keywords |
Restriction endonuclease LpnPI
|
publication title |
Structure-guided sequence specificity engineering of the modification-dependent restriction endonuclease LpnPI.
pubmed doi rcsb |
source organism |
Legionella pneumophila subsp. pneumophila str. philadelphia 1
|
total genus |
57
|
structure length |
227
|
sequence length |
227
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2014-12-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF18062 | RE_AspBHI_N | Restriction endonuclease AspBHI N-terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | PUA domain-like | PUA domain-like |
#chains in the Genus database with same CATH superfamily 4RZL A; 4F0Q A; 4F0P A; 4OC8 A; 4R28 A; #chains in the Genus database with same CATH topology 4RZL A; 3BI7 A; 3Q0B X; 4OC8 A; 2ZKD A; 2ZKF A; 3CLZ A; 2ZO2 B; 3OLN A; 4PW5 A; 3FDE A; 3F8I A; 4NJ5 A; 2ZKE A; 2ZKG A; 4F0Q A; 4F0P A; 2ZO1 B; 3DWH A; 3Q0D A; 4PW7 A; 3Q0C A; 2PB7 A; 2ZO0 B; 3F8J B; 4YGI A; 4PW6 A; 3Q0F A; 4R28 A; #chains in the Genus database with same CATH homology 4RZL A; 4F0Q A; 4R28 A; 4F0P A; 3Q0B X; 4OC8 A; 3Q0D A; 3Q0C A; 3Q0F A; 4YGI A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...