1D0QA

Structure of the zinc-binding domain of bacillus stearothermophilus dna primase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
102
structure length
102
Chain Sequence
GHRIPEETIEAIRRGVDIVDVIGEYVQLKRQGRNYFGLCPFHGEKTPSFSVSPEKQIFHCFGCGAGGNAFTFLMDIEGIPFVEAAKRLAAKAGVDLSVYELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the zinc-binding domain of Bacillus stearothermophilus DNA primase.
pubmed doi rcsb
molecule keywords DNA PRIMASE
molecule tags Transferase
source organism Geobacillus stearothermophilus
total genus 27
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 1999-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01807 zf-CHC2 CHC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.580.10 Alpha Beta Alpha-Beta Complex DNA Primase; Chain A Zinc finger, CHC2-type domain 1d0qA00
1D0QA 2AU3A
chains in the Genus database with same CATH superfamily
1D0QA 2AU3A
chains in the Genus database with same CATH topology
1D0QA 2AU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D0Q A;  2AU3 A; 
#chains in the Genus database with same CATH topology
 1D0Q A;  2AU3 A; 
#chains in the Genus database with same CATH homology
 1D0Q A;  2AU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...