1E8RA

Solution structure of type x cbd
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
50
structure length
50
Chain Sequence
MGNQQCNWYGTLYPLCVTTTNGWGWEDQRSCIARSTCAAQPAPFGIVGSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Solution Structure of the Cbm10 Cellulose Binding Module from Pseudomonas Xylanase A
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 3
structure length 50
sequence length 50
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02013 CBM_10 Cellulose or protein binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.32.30 Mainly Beta Roll Xylanase; Chain A CBM10 1e8rA00
1QLDA 1E8RA
chains in the Genus database with same CATH superfamily
1QLDA 1E8RA
chains in the Genus database with same CATH topology
1QLDA 1E8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLD A;  1E8R A; 
#chains in the Genus database with same CATH topology
 1QLD A;  1E8R A; 
#chains in the Genus database with same CATH homology
 1QLD A;  1E8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...