The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
137
|
structure length |
137
|
Chain Sequence |
TRINLTLVSELADQHLMAEYRQLPRVFGAVRKHVANGKRVRDFKISPTFILGAGHVTFFYDKLEFLRKRQIELIAECLKRGFNIKDTTVQDISDIPQEFRGDYIPHEASIAISQARLDEKIAQRPTWYKYYGKAIYA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Endonuclease
|
molecule keywords |
ENDONUCLEASE V
|
publication title |
Crystal structure of a pyrimidine dimer-specific excision repair enzyme from bacteriophage T4: refinement at 1.45 A and X-ray analysis of the three active site mutants.
pubmed doi rcsb |
source organism |
Enterobacteria phage t4
|
total genus |
41
|
structure length |
137
|
sequence length |
137
|
ec nomenclature |
ec
3.2.2.17: Deoxyribodipyrimidine endonucleosidase. |
pdb deposition date | 1994-08-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03013 | Pyr_excise | Pyrimidine dimer DNA glycosylase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Endonuclease V | T4 endonuclease V |
#chains in the Genus database with same CATH superfamily 2FCC A; 1ENJ A; 1ENK A; 1ENI A; 1VAS A; 2END A; #chains in the Genus database with same CATH topology 2FCC A; 1ENJ A; 1ENK A; 1ENI A; 1VAS A; 2END A; #chains in the Genus database with same CATH homology 2FCC A; 1ENJ A; 1ENK A; 1ENI A; 1VAS A; 2END A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...